PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009629763.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 707aa    MW: 78174.6 Da    PI: 5.2785
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009629763.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.1e-2046102157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     r++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  XP_009629763.1  46 RKRYHRHTQHQIQEMENFFKNCPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 102
                     789999************************************************995 PP

2START187.66.3e-592314511206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela +a++e++++a+ +ep+W  s       +n++e+++ f+ + +     +++ea+++++vv+m++ +lve+l+d + +W+ ++      a t+
  XP_009629763.1 231 ELAVAAMEEFIQMAQMGEPLWLPSIdrrtNFLNEEEYVRLFPLGIGpklegFKTEASKDTAVVFMNHIKLVEILMDAN-KWSSMFSsivsTAVTV 324
                     57899********************999999**********99999********************************.*******999999*** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +v+s+g      galq+++ae+q++ p vp Rd +fvRy++++ +g w++vdvS+d  +  p+    +R++++pSg+li++++ng+skvtw+ehv
  XP_009629763.1 325 DVLSTGvagnfnGALQVIFAEFQVPFPQVPtRDCYFVRYCKRSVDGIWAVVDVSLDYLRATPT----ARCRRRPSGCLIQEMPNGYSKVTWIEHV 415
                     ************************************************************996....**************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     + ++  + +++++l++sgla+gak+w atl+rqce+
  XP_009629763.1 416 EADDTAIYSIYKPLLNSGLAFGAKRWIATLDRQCER 451
                     **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-2125101IPR009057Homeodomain-like
SuperFamilySSF466891.46E-1935104IPR009057Homeodomain-like
PROSITE profilePS5007117.34643103IPR001356Homeobox domain
SMARTSM003894.8E-1944107IPR001356Homeobox domain
CDDcd000861.38E-1945104No hitNo description
PfamPF000465.6E-1846101IPR001356Homeobox domain
PROSITE patternPS00027078101IPR017970Homeobox, conserved site
SuperFamilySSF559614.62E-35222453No hitNo description
PROSITE profilePS5084842.466222454IPR002913START domain
CDDcd088756.89E-120226450No hitNo description
SMARTSM002342.6E-53231451IPR002913START domain
PfamPF018521.1E-47232451IPR002913START domain
Gene3DG3DSA:3.30.530.202.6E-7299451IPR023393START-like domain
SuperFamilySSF559613.08E-23482698No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MDMASNTSES ELMPLLTEEE FDSKSGSDNQ EGKSSDEQDA NQSERRKRYH RHTQHQIQEM  60
ENFFKNCPHP DDKQRKELSR ELGLEPLQVK FWFQNKRTQM KNQNERSELS SLRDENEKLR  120
TEHVQIREAL NNATSCPSCP ICGGPQISLG EMSFEENQLR IENARLKEEV DRISAFAAKH  180
LGKPVSSLNV YSSPVTPPSS LDLGNAFGNN GEVLRSSFNG PTEAEKPFII ELAVAAMEEF  240
IQMAQMGEPL WLPSIDRRTN FLNEEEYVRL FPLGIGPKLE GFKTEASKDT AVVFMNHIKL  300
VEILMDANKW SSMFSSIVST AVTVDVLSTG VAGNFNGALQ VIFAEFQVPF PQVPTRDCYF  360
VRYCKRSVDG IWAVVDVSLD YLRATPTARC RRRPSGCLIQ EMPNGYSKVT WIEHVEADDT  420
AIYSIYKPLL NSGLAFGAKR WIATLDRQCE RLASAMATNL PDDNTTNMIL GGPEGRRSVL  480
KLAERMVISY CSGVSATAAH QWTTLSGSGS ENDVRIMFRK SINDPGRPPG IVMCAATSFW  540
LPISPKTAFD FLRDENTRSE WDILSNGGVI QRLVHIANGR ETGNSVSILR VNSSANLRQN  600
NMLILQESST DPTGSFVVYA PVDVPAMNTV INGGDPDYVA LLPSGFAILP DGPPGRIAGG  660
SLLTIAFQIL VDSVPTAKLS LGSVATVNKL IACTVDKIRA ALLSDTP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629763.10.0PREDICTED: homeobox-leucine zipper protein ROC2-like isoform X3
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLD7TEM30.0D7TEM3_VITVI; Putative uncharacterized protein
STRINGVIT_12s0059g02310.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2